Search :
Sign in or Register  
Welcome Sign in or Don't have an account?Register

Mouse Anti-LAMA2 Recombinant Antibody (CBYJL-1081) (CBMAB-L0528-YJ)

Online Inquiry

Summary

Host Animal
Mouse
Specificity
Human, Mouse, Rat
Clone
CBYJL-1081
Antibody Isotype
IgG1
Application
WB, IHC-P

Basic Information

Immunogen
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence DKLKPIKELEDNLKKNISEIKELINQARKQANSIKVSVSSGGDCIRTYKPEIKKGSYNNIVVNVKTAVADNLLFYLGSAKFIDFLAIEMRKGKVSFLWDVGSGVGRVEYPDLTIDDSYWYRIVASRTGRNGT.
Specificity
Human, Mouse, Rat
Antibody Isotype
IgG1
Clonality
Monoclonal
Application Notes
The COA includes recommended starting dilutions, optimal dilutions should be determined by the end user.

Formulations & Storage [For reference only, actual COA shall prevail!]

Buffer
PBS, pH 7.4
Storage
Store at 4°C short term (1-2 weeks). Aliquot and store at -20°C long term. Avoid repeated freeze/thaw cycles.

Target

Full Name
laminin, alpha 2
Introduction
Laminin, an extracellular protein, is a major component of the basement membrane. It is thought to mediate the attachment, migration, and organization of cells into tissues during embryonic development by interacting with other extracellular matrix components. It is composed of three subunits, alpha, beta, and gamma, which are bound to each other by disulfide bonds into a cross-shaped molecule. LAMA2 is the alpha 2 chain, which constitutes one of the subunits of laminin 2 (merosin) and laminin 4 (s-merosin). Mutations in this gene have been identified as the reason of congenital merosin-deficient muscular dystrophy. Two transcript variants encoding different proteins have been described for this gene. Among its related pathways are ERK Signaling and Focal Adhesion.
Entrez Gene ID
Human3908
Mouse16773
Rat309368
UniProt ID
HumanP24043
MouseQ60675
RatF1M614
Alternative Names
LAMM
Function
Binding to cells via a high affinity receptor, laminin is thought to mediate the attachment, migration and organization of cells into tissues during embryonic development by interacting with other extracellular matrix components.
Biological Process
Animal organ morphogenesisManual Assertion Based On ExperimentIBA:GO_Central
Axon guidanceManual Assertion Based On ExperimentIBA:GO_Central
Cell adhesionIEA:UniProtKB-KW
Maintenance of blood-brain barrier1 PublicationNAS:ARUK-UCL
Muscle organ developmentManual Assertion Based On ExperimentTAS:ProtInc
Positive regulation of synaptic transmission, cholinergicIEA:Ensembl
Regulation of cell adhesionIEA:InterPro
Regulation of cell migrationIEA:InterPro
Regulation of embryonic developmentIEA:InterPro
Tissue developmentManual Assertion Based On ExperimentIBA:GO_Central
Cellular Location
Secreted, extracellular space, extracellular matrix, basement membrane
Major component.
Involvement in disease
Merosin-deficient congenital muscular dystrophy 1A (MDC1A):
Characterized by difficulty walking, hypotonia, proximal weakness, hyporeflexia, and white matter hypodensity on MRI.
Muscular dystrophy, limb-girdle, autosomal recessive 23 (LGMDR23):
A form of autosomal recessive limb-girdle muscular dystrophy, a myopathy characterized by proximal and/or distal muscle weakness and atrophy. The age at onset is variable and can range from the first to the sixth decade, although later onset is less common. LGMDR23 is characterized by slowly progressive proximal muscle weakness primarily affecting the lower limbs, increased serum creatine kinase, dystrophic features, gait difficulties, and white matter abnormalities on brain imaging. Age at onset generally ranges from childhood to mid-adulthood. Some patients may have additional neurologic features, including executive deficits, seizures, and peripheral neuropathy.
More Infomation

Li, S., Hu, J., Li, G., Mai, H., Gao, Y., Liang, B., ... & Duan, Y. (2023). Epigenetic regulation of LINC01270 in breast cancer progression by mediating LAMA2 promoter methylation and MAPK signaling pathway. Cell biology and toxicology, 39(4), 1359-1375.

Tan, D., Ge, L., Fan, Y., Chang, X., Wang, S., Wei, C., ... & Xiong, H. (2021). Natural history and genetic study of LAMA2-related muscular dystrophy in a large Chinese cohort. Orphanet Journal of Rare Diseases, 16(1), 1-12.

Gawlik, K. I., & Durbeej, M. (2020). A family of laminin α2 chain-deficient mouse mutants: advancing the research on LAMA2-CMD. Frontiers in Molecular Neuroscience, 13, 59.

Barraza-Flores, P., Bates, C. R., Oliveira-Santos, A., & Burkin, D. J. (2020). Laminin and integrin in LAMA2-related congenital muscular dystrophy: from disease to therapeutics. Frontiers in molecular neuroscience, 13, 1.

Oliveira, J. P. F. J., Santos, M., & Coelho, T. (2020). LAMA2 muscular dystrophy.

Sarkozy, A., Foley, A. R., Zambon, A. A., Bönnemann, C. G., & Muntoni, F. (2020). LAMA2-related dystrophies: clinical phenotypes, disease biomarkers, and clinical trial readiness. Frontiers in Molecular Neuroscience, 13, 123.

Previtali, S. C., & Zambon, A. A. (2020). LAMA2 neuropathies: human findings and pathomechanisms from mouse models. Frontiers in molecular neuroscience, 13, 60.

Zhu, Y., Zhang, X., Gu, R., Liu, X., Wang, S., Xia, D., ... & Zhou, Y. (2020). LAMA2 regulates the fate commitment of mesenchymal stem cells via hedgehog signaling. Stem cell research & therapy, 11(1), 1-10.

Liang, J., Li, H., Han, J., Jiang, J., Wang, J., Li, Y., ... & Tian, H. (2020). Mex3a interacts with LAMA2 to promote lung adenocarcinoma metastasis via PI3K/AKT pathway. Cell death & disease, 11(8), 614.

Oliveira, J., Gruber, A., Cardoso, M., Taipa, R., Fineza, I., Gonçalves, A., ... & Sousa, M. (2018). LAMA2 gene mutation update: Toward a more comprehensive picture of the laminin‐α2 variome and its related phenotypes. Human mutation, 39(10), 1314-1337.

Ask a question We look forward to hearing from you.
0 reviews or Q&As
Loading...
Have you used Mouse Anti-LAMA2 Recombinant Antibody (CBYJL-1081)?
Submit a review and get a Coupon or an Amazon gift card. 20% off Coupon $30 eGift Card
Submit a review
Loading...
For research use only. Not intended for any clinical use.

Custom Antibody Labeling

We also offer labeled antibodies developed using our catalog antibody products and nonfluorescent conjugates (HRP, AP, Biotin, etc.) or fluorescent conjugates (Alexa Fluor, FITC, TRITC, Rhodamine, Texas Red, R-PE, APC, Qdot Probes, Pacific Dyes, etc.).

Learn more

Documents

Online Inquiry