Search :
Sign in or Register  
Welcome Sign in or Don't have an account?Register

Mouse Anti-CS Recombinant Antibody (CBXC-1882) (CBMAB-C3743-CQ)

Online Inquiry

Summary

Host Animal
Mouse
Specificity
Human
Clone
CBXC-1882
Antibody Isotype
IgG1
Application
WB, IHC

Basic Information

Immunogen
Recombinant Protein corresponding to amino acids:ADLIPKEQARIKTFRQQHGKTVVGQITVDMMYGGMRGMKGLVYETSVLDPDEGIRFRGFSIPECQKLLPKAKGGEEPLPEGLFWLLVTGHIPTEEQVSWL
Specificity
Human
Antibody Isotype
IgG1
Clonality
Monoclonal
Application Notes
The COA includes recommended starting dilutions, optimal dilutions should be determined by the end user.

Formulations & Storage [For reference only, actual COA shall prevail!]

Storage
Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C long term. Avoid repeated freeze/thaw cycles.

Target

Full Name
Citrate Synthase
Introduction
CS (Citrate Synthase) is a Protein Coding gene. Diseases associated with CS include Critical Illness Polyneuropathy and Cat-Scratch Disease. Among its related pathways are Respiratory electron transport, ATP synthesis by chemiosmotic coupling, and heat production by uncoupling proteins. and Pyruvate metabolism and Citric Acid (TCA) cycle. Gene Ontology (GO) annotations related to this gene include citrate (Si)-synthase activity.
Entrez Gene ID
UniProt ID
Alternative Names
Citrate Synthase; EC 2.3.3.1; Citrate (Si)-Synthase; EC 2.3.3;
Biological Process
Carbohydrate metabolic process Source: UniProtKB
Citrate metabolic process Source: InterPro
Tricarboxylic acid cycle Source: GO_Central
Cellular Location
Mitochondrion matrix
PTM
Methylated (PubMed:28391595, PubMed:28887308). Trimethylation at Lys-395 by CSKMT decreases citrate synthase activity (PubMed:28887308).
More Infomation

Zhao, H., Chen, G., Sang, L., Deng, Y., Gao, L., Yu, Y., & Liu, J. (2021). Mitochondrial citrate synthase plays important roles in anthocyanin synthesis in petunia. Plant Science, 305, 110835.

Cai, Z., Deng, Y., Ye, J., Zhuo, Y., Liu, Z., Liang, Y., ... & Zhong, W. (2020). Aberrant expression of citrate synthase is linked to disease progression and clinical outcome in prostate cancer. Cancer Management and Research, 12, 6149.

Ito, S., Koyama, N., & Osanai, T. (2019). Citrate synthase from Synechocystis is a distinct class of bacterial citrate synthase. Scientific reports, 9(1), 1-9.

Verschueren, K. H., Blanchet, C., Felix, J., Dansercoer, A., De Vos, D., Bloch, Y., ... & Verstraete, K. (2019). Structure of ATP citrate lyase and the origin of citrate synthase in the Krebs cycle. Nature, 568(7753), 571-575.

Alhindi, Y., Vaanholt, L. M., Al-Tarrah, M., Gray, S. R., Speakman, J. R., Hambly, C., ... & Ratkevicius, A. (2019). Low citrate synthase activity is associated with glucose intolerance and lipotoxicity. Journal of nutrition and metabolism, 2019.

Mustafa, G., Arif, R., Bukhari, S. A., Ali, M., Sharif, S., & Atta, A. (2018). Structural and functional annotation of citrate synthase from Aspergillus niger ANJ-120. Pakistan journal of pharmaceutical sciences, 31.

Rhein, V. F., Carroll, J., Ding, S., Fearnley, I. M., & Walker, J. E. (2017). Human METTL12 is a mitochondrial methyltransferase that modifies citrate synthase. FEBS letters, 591(12), 1641-1652.

Cui, X. X., Li, X., Dong, S. Y., Guo, Y. J., Liu, T., & Wu, Y. C. (2017). SIRT3 deacetylated and increased citrate synthase activity in PD model. Biochemical and biophysical research communications, 484(4), 767-773.

Cai, Q., Zhao, M., Liu, X., Wang, X., Nie, Y., Li, P., ... & Han, F. (2017). Reduced expression of citrate synthase leads to excessive superoxide formation and cell apoptosis. Biochemical and biophysical research communications, 485(2), 388-394.

MacPherson, S., Horkoff, M., Gravel, C., Hoffmann, T., Zuber, J., & Lum, J. J. (2017). STAT3 regulation of citrate synthase is essential during the initiation of lymphocyte cell growth. Cell reports, 19(5), 910-918.

Ask a question We look forward to hearing from you.
0 reviews or Q&As
Loading...
Have you used Mouse Anti-CS Recombinant Antibody (CBXC-1882)?
Submit a review and get a Coupon or an Amazon gift card. 20% off Coupon $30 eGift Card
Submit a review
Loading...
For research use only. Not intended for any clinical use.

Custom Antibody Labeling

We also offer labeled antibodies developed using our catalog antibody products and nonfluorescent conjugates (HRP, AP, Biotin, etc.) or fluorescent conjugates (Alexa Fluor, FITC, TRITC, Rhodamine, Texas Red, R-PE, APC, Qdot Probes, Pacific Dyes, etc.).

Learn more

Documents

Online Inquiry