Search :
Sign in or Register  
Welcome Sign in or Don't have an account?Register

Mouse Anti-AMH Recombinant Antibody (5/6) (CBMAB-A2527-YC)


See all AMH antibodies
Online Inquiry
Published Data
Mouse Anti-AMH Recombinant Antibody (5/6) in IHC
Immunostaining for AMH in fresh donor tissue and grafts from young (A-C) and older donors (D-F). Before transplantation AMH was expressed in young donors (A) and less intensely in the older donors (D). Four (B and E) and nine months (C and F) after transplantation, AMH was still expressed in grafts from young donors (B and C) as well as in grafts from older donors (E and F). Nine months after transplantation, AMH was very weakly expressed in tubules where differentiation was going on (rectangle in G). Tubules with differentiation (rectangle) were proven to be of human origin by vimentin staining (H). Expression of inhibin in same tubule (I). ...View More
Van Saen, D., Goossens, E., Bourgain, C., Ferster, A., & Tournaye, H. (2011). Meiotic activity in orthotopic xenografts derived from human postpubertal testicular tissue. Human reproduction, 26(2), 282-293.
Mouse Anti-AMH Recombinant Antibody (5/6) in IHC
Immunohistochemical localisation of AMH in bouin-fixed ovaries of adult mice. (A) AMH is expressed in granulosa cells of small growing follicles, like primary (PY), preantral (PA) and small antral (SA) follicles,
but not in atretic follicles (At). (B) AMH expression disappears in larger antral follicles (A) and in atretic follicles (At). ...View More
Gruijters, M. J., Visser, J. A., Durlinger, A. L., & Themmen, A. P. (2003). Anti-Müllerian hormone and its role in ovarian function. Molecular and cellular endocrinology, 211(1-2), 85-90.
Mouse Anti-AMH Recombinant Antibody (5/6) in IHC
Micrographs of anti-MuÈllerian hormone (AMH) immunohistochemical stained human ovarian tissue sections. Speci®c (brown) AMH stain deposition is present in the cytoplasm of granulosa cells. Scale bar = 100 mm. Sections A, D and G are controls; sections B, E and H were stained using the MIS C-20 antibody; sections C, F and I using the 5/6A antibody. (A±C) Adjacent sections at 3100 magni®cation with a primordial follicle (arrowhead), a primary follicle (small arrow) and a secondary follicle (large arrow). Primordial follicles show no immunostaining of the cytoplasma of the granulosa cells, whereas the primary follicles show normal staining (+) with both the MIS C-20 and 5/6A antibodies. Secondary follicle shows strong staining (++) with both antibodies. (D±F) Adjacent sections at 340 magni®cation with a small antral follicle <1 mm. The oocyte shows weak, non-speci®c brown staining (arrowhead), whereas the granulosa cells, especially of the cumulus (arrow), show strong staining (++) with both antibodies. (G±I) Adjacent sections at 3100 magni®cation showing two larger antral follicles. The follicle on the left side with a diameter of 6.1 mm shows weak staining (+/±) of the granulosa cells (arrowhead), whereas the smaller follicle on the right side (arrow) with a diameter of 2.5 mm shows normal staining (+) with both antibodies. (J±L) Adjacent sections at 340 magni®cation with a small antral follicle <1 mm. The oocyte shows weak, non-speci®c brown staining (arrowhead). The granulosa cells show strong staining (++) with the 5/6A antibody. When the peptide is added to the antibody, no immunohistochemical staining occurs (K). ...View More
Weenen, C., Laven, J. S., Von Bergh, A. R., Cranfield, M., Groome, N. P., Visser, J. A., ... & Themmen, A. P. (2004). Anti-Müllerian hormone expression pattern in the human ovary: potential implications for initial and cyclic follicle recruitment. Molecular human reproduction, 10(2), 77-83.
Mouse Anti-AMH Recombinant Antibody (5/6) in IHC
Immature seminiferous tubules show strong cytoplasmic staining for antimullerian hormone € (AMH), but the spermatogonia (short arrow) and Leydig cells (long arrow) are negative for AMH (EnVision/DAB). ...View More
Papanastasopoulos, P., Panagidis, A., Verras, D., Repanti, M., & Georgiou, G. (2009). A case of complete androgen insensitivity syndrome presenting with incarcerated inguinal hernia: an immunohistochemical study. Fertility and Sterility, 92(3), 1169-e11.

Summary

Host Animal
Mouse
Specificity
Human, Monkey, Mouse, Sheep
Clone
5/6
Antibody Isotype
IgG1
Application
WB, IHC-P

Basic Information

Immunogen
Synthetic peptide derived from human AMH (VPTAYAGKLLISLSEERISAHHVPNMVATEC).
Host Species
Mouse
Specificity
Human, Monkey, Mouse, Sheep
Antibody Isotype
IgG1
Clonality
Monoclonal
Application Notes
The COA includes recommended starting dilutions, optimal dilutions should be determined by the end user.
ApplicationNote
IHC-P1:20-1:40

Formulations & Storage [For reference only, actual COA shall prevail!]

Format
Supernatant
Buffer
0.1M Tris/HCl pH7.4, 5-10% foetal calf serum.
Preservative
0.1% sodium azide
Concentration
Batch dependent
Storage
Store at 4°C short term (1-2 weeks). Aliquot and store at -20°C long term. Avoid repeated freeze/thaw cycles.

Target

Full Name
Anti-Mullerian Hormone
Introduction
AMH is a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate gene expres
Entrez Gene ID
Human268
Mouse11705
Monkey717539
Sheep101121773
UniProt ID
HumanP03971
MouseP27106
MonkeyA0A0D9RH05
SheepT1SHH2
Alternative Names
Anti-Mullerian Hormone; Muellerian-Inhibiting Substance; Anti-Muellerian Hormone; MIF; MIS; Mullerian Inhibiting Substance; Muellerian-Inhibiting Factor; Mullerian Inhibiting Factor;
Function
This glycoprotein, produced by the Sertoli cells of the testis, causes regression of the Muellerian duct. It is also able to inhibit the growth of tumors derived from tissues of Muellerian duct origin.
Biological Process
Aging Source: Ensembl
BMP signaling pathway Source: Reactome
Cell-cell signaling Source: ProtInc
Gonadal mesoderm development Source: UniProtKB-KW
Mullerian duct regression Source: UniProtKB
Negative regulation of ovarian follicle development Source: Ensembl
Positive regulation of gene expression Source: UniProtKB
Positive regulation of NF-kappaB transcription factor activity Source: Ensembl
Preantral ovarian follicle growth Source: Ensembl
Response to drug Source: Ensembl
Response to organic cyclic compound Source: Ensembl
Sex determination Source: ProtInc
Sex differentiation Source: UniProtKB
Urogenital system development Source: GO_Central
Cellular Location
Secreted
Involvement in disease
Persistent Muellerian duct syndrome 1 (PMDS1): A form of male pseudohermaphroditism characterized by a failure of Muellerian duct regression in otherwise normal males.
More Infomation

Moolhuijsen, L. M., & Visser, J. A. (2020). Anti-Müllerian hormone and ovarian reserve: Update on assessing ovarian function. The Journal of Clinical Endocrinology & Metabolism, 105(11), 3361-3373.

Hoyos, L. R., Visser, J. A., McLuskey, A., Chazenbalk, G. D., Grogan, T. R., & Dumesic, D. A. (2020). Loss of anti-Müllerian hormone (AMH) immunoactivity due to a homozygous AMH gene variant rs10417628 in a woman with classical polycystic ovary syndrome (PCOS). Human Reproduction, 35(10), 2294-2302.

Huang, X., Xu, X., Dai, Y., Cheng, Z., Zheng, X., & Huo, X. (2020). Association of prenatal exposure to PAHs with anti-Müllerian hormone (AMH) levels and birth outcomes of newborns. Science of the Total Environment, 723, 138009.

Zhang, Z., Zhu, B., Chen, W., & Ge, W. (2020). Anti-Müllerian hormone (Amh/amh) plays dual roles in maintaining gonadal homeostasis and gametogenesis in zebrafish. Molecular and Cellular Endocrinology, 110963.

Xu, H. Y., Zhang, H. X., Xiao, Z., Qiao, J., & Li, R. (2019). Regulation of anti-Müllerian hormone (AMH) in males and the associations of serum AMH with the disorders of male fertility. Asian journal of andrology, 21(2), 109.

Yan, Y. L., Batzel, P., Titus, T., Sydes, J., Desvignes, T., BreMiller, R., ... & Postlethwait, J. H. (2019). A hormone that lost its receptor: anti-Müllerian hormone (AMH) in zebrafish gonad development and sex determination. Genetics, 213(2), 529-553.

Abbara, A., Eng, P. C., Phylactou, M., Clarke, S. A., Hunjan, T., Roberts, R., ... & Dhillo, W. S. (2019). Anti-Müllerian hormone (AMH) in the diagnosis of menstrual disturbance due to polycystic ovarian syndrome. Frontiers in endocrinology, 10, 656.

Sova, H., Unkila-Kallio, L., Tiitinen, A., Hippeläinen, M., Perheentupa, A., Tinkanen, H., ... & Morin-Papunen, L. (2019). Hormone profiling, including anti-Müllerian hormone (AMH), for the diagnosis of polycystic ovary syndrome (PCOS) and characterization of PCOS phenotypes. Gynecological Endocrinology, 35(7), 595-600.

Stracquadanio, M., Ciotta, L., & Palumbo, M. A. (2018). Relationship between serum anti-Mullerian hormone and intrafollicular AMH levels in PCOS women. Gynecological Endocrinology, 34(3), 223-228.

Kruszyńska, A., & Słowińska-Srzednicka, J. (2017). Anti-Müllerian hormone (AMH) as a good predictor of time of menopause. Przeglad menopauzalny= Menopause review, 16(2), 47.

Ask a question We look forward to hearing from you.
0 reviews or Q&As

Purchasing FAQs
Technical FAQs

Loading...
Have you used Mouse Anti-AMH Recombinant Antibody (5/6)?
Submit a review and get a Coupon or an Amazon gift card. 20% off Coupon $30 eGift Card
Submit a review
Loading...
For research use only. Not intended for any clinical use.

Custom Antibody Labeling

We also offer labeled antibodies developed using our catalog antibody products and nonfluorescent conjugates (HRP, AP, Biotin, etc.) or fluorescent conjugates (Alexa Fluor, FITC, TRITC, Rhodamine, Texas Red, R-PE, APC, Qdot Probes, Pacific Dyes, etc.).

Learn more

Documents

Request bulk or custom quoteOnline Inquiry
Second antibody and isotype control

Contact us

  • Tel: (USA)
  • (UK)
  • Fax:
  • Email:

Submit A Review

Online Inquiry