Search :
Sign in or Register  
Welcome Sign in or Don't have an account?Register

Mouse Anti-IDH1 Recombinant Antibody (16H7) (CBMAB-BR278LY)

Online Inquiry

Summary

Host Animal
Mouse
Specificity
Human, Mouse, Rat
Clone
16H7
Antibody Isotype
IgG
Application
FC: 1-3 μg/1x10 cells, IF: 1:1000 dilution, ICC: 1:200 dilution, WB: 0.1-0.5 μg/ml

Basic Information

Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human IDH1 (381-413aa KGLPNVQRSDYLNTFEFMDKLGENLKIKLAQAK), different from the related mouse and rat sequences by one amino acid.
Specificity
Human, Mouse, Rat
Antibody Isotype
IgG
Clonality
Monoclonal
Application Notes
The COA includes recommended starting dilutions, optimal dilutions should be determined by the end user.

Formulations & Storage [For reference only, actual COA shall prevail!]

Format
Liquid
Preservative
0.05 mg sodium azide
Storage
Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C long term. Avoid repeated freezethaw cycles.

Target

Full Name
Isocitrate Dehydrogenase (NADP(+)) 1, Cytosolic
Introduction
Isocitrate dehydrogenases catalyze the oxidative decarboxylation of isocitrate to 2-oxoglutarate. These enzymes belong to two distinct subclasses, one of which utilizes NAD(+) as the electron acceptor and the other NADP(+). Five isocitrate dehydrogenases have been reported: three NAD(+)-dependent isocitrate dehydrogenases, which localize to the mitochondrial matrix, and two NADP(+)-dependent isocitrate dehydrogenases, one of which is mitochondrial and the other predominantly cytosolic. Each NADP(+)-dependent isozyme is a homodimer. The protein encoded by this gene is the NADP(+)-dependent isocitrate dehydrogenase found in the cytoplasm and peroxisomes. It contains the PTS-1 peroxisomal targeting signal sequence. The presence of this enzyme in peroxisomes suggests roles in the regeneration of NADPH for intraperoxisomal reductions, such as the conversion of 2, 4-dienoyl-CoAs to 3-enoyl-CoAs, as well as in peroxisomal reactions that consume 2-oxoglutarate, namely the alpha-hydroxylation of phytanic acid. The cytoplasmic enzyme serves a significant role in cytoplasmic NADPH production. Alternatively spliced transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Sep 2013]
Entrez Gene ID
Human3417
Mouse15926
Rat24479
UniProt ID
HumanO75874
MouseO88844
RatP41562
Alternative Names
Cytosolic NADP isocitrate dehydrogenase antibody|Cytosolic NADP-isocitrate dehydrogenase antibody|Epididymis luminal protein 216 antibody|Epididymis secretory protein Li 26 antibody|HEL-216 antibody|HEL-S-26 antibody|ICDH antibody|IDCD antibody|IDH antibody|IDH1 antibody|IDHC_HUMAN antibody|IDP antibody|IDPC antibody|Isocitrate dehydrogenase [NADP] cytoplasmic antibody|Isocitrate dehydrogenase 1 (NADP+) soluble antibody|NADP dependent isocitrate dehydrogenase cytosolic antibody|NADP dependent isocitrate dehydrogenase peroxisomal antibody|NADP(+)-specific ICDH antibody|Oxalosuccinate decarboxylase antibody|PICD antibody
Biological Process
2-oxoglutarate metabolic process Source: UniProtKB
Female gonad development Source: Ensembl
Glutathione metabolic process Source: Ensembl
Glyoxylate cycle Source: UniProtKB-KW
Isocitrate metabolic process Source: UniProtKB
NADP metabolic process Source: GO_Central
Regulation of phospholipid biosynthetic process Source: Ensembl
Regulation of phospholipid catabolic process Source: Ensembl
Response to oxidative stress Source: Ensembl
Response to steroid hormone Source: Ensembl
Tricarboxylic acid cycle Source: UniProtKB-KW
Cellular Location
Peroxisome; Cytosol
Involvement in disease
Glioma (GLM):
The gene represented in this entry is involved in disease pathogenesis. Mutations affecting Arg-132 are tissue-specific, and suggest that this residue plays a unique role in the development of high-grade gliomas. Mutations of Arg-132 to Cys, His, Leu or Ser abolish magnesium binding and abolish the conversion of isocitrate to alpha-ketoglutarate. Instead, alpha-ketoglutarate is converted to R(-)-2-hydroxyglutarate. Elevated levels of R(-)-2-hydroxyglutarate are correlated with an elevated risk of malignant brain tumors. Gliomas are benign or malignant central nervous system neoplasms derived from glial cells. They comprise astrocytomas and glioblastoma multiforme that are derived from astrocytes, oligodendrogliomas derived from oligodendrocytes and ependymomas derived from ependymocytes. Genetic variations are associated with cartilaginous tumors such as enchondroma or chondrosarcoma. Mutations of Arg-132 to Cys, Gly or His abolish the conversion of isocitrate to alpha-ketoglutarate. Instead, alpha-ketoglutarate is converted to R(-)-2-hydroxyglutarate.
PTM
Acetylation at Lys-374 dramatically reduces catalytic activity.
More Infomation

Sabo, K. A., Albekioni, E., Caliger, D., Coleman, N. J., Thornberg, E., Avellaneda Matteo, D., ... & Sohl, C. D. (2023). Capturing the Dynamic Conformational Changes of Human Isocitrate Dehydrogenase 1 (IDH1) upon Ligand and Metal Binding Using Hydrogen–Deuterium Exchange Mass Spectrometry. Biochemistry, 62(6), 1145-1159.

Reinbold, R., Hvinden, I. C., Rabe, P., Herold, R. A., Finch, A., Wood, J., ... & Schofield, C. J. (2022). Resistance to the isocitrate dehydrogenase 1 mutant inhibitor ivosidenib can be overcome by alternative dimer-interface binding inhibitors. Nature Communications, 13(1), 4785.

Herold, R. A., Reinbold, R., Megarity, C. F., Abboud, M. I., Schofield, C. J., & Armstrong, F. A. (2021). Exploiting electrode nanoconfinement to investigate the catalytic properties of isocitrate dehydrogenase (IDH1) and a cancer-associated variant. The Journal of Physical Chemistry Letters, 12(26), 6095-6101.

Liu, S., Abboud, M. I., John, T., Mikhailov, V., Hvinden, I., Walsby-Tickle, J., ... & Schofield, C. J. (2021). Roles of metal ions in the selective inhibition of oncogenic variants of isocitrate dehydrogenase 1. Communications Biology, 4(1), 1243.

Bruce-Brand, C., & Govender, D. (2020). Gene of the month: IDH1. Journal of Clinical Pathology, 73(10), 611-615.

Bhavya, B., Anand, C. R., Madhusoodanan, U. K., Rajalakshmi, P., Krishnakumar, K., Easwer, H. V., ... & Gopala, S. (2020). To be wild or mutant: role of isocitrate dehydrogenase 1 (IDH1) and 2-hydroxy glutarate (2-HG) in gliomagenesis and treatment outcome in glioma. Cellular and molecular neurobiology, 40, 53-63.

Luna, L. A., Lesecq, Z., White, K. A., Hoang, A., Scott, D. A., Zagnitko, O., ... & Sohl, C. D. (2020). An acidic residue buried in the dimer interface of isocitrate dehydrogenase 1 (IDH1) helps regulate catalysis and pH sensitivity. Biochemical journal, 477(16), 2999-3018.

Verdura, S., Cuyàs, E., Lozano-Sánchez, J., Bastidas-Velez, C., Llorach-Parés, L., Fernández-Arroyo, S., ... & Menendez, J. A. (2019). An olive oil phenolic is a new chemotype of mutant isocitrate dehydrogenase 1 (IDH1) inhibitors. Carcinogenesis, 40(1), 27-40.

Jakob, C. G., Upadhyay, A. K., Donner, P. L., Nicholl, E., Addo, S. N., Qiu, W., ... & Hutti, J. E. (2018). Novel modes of inhibition of wild-type isocitrate dehydrogenase 1 (IDH1): direct covalent modification of His315. Journal of Medicinal Chemistry, 61(15), 6647-6657.

Ask a question We look forward to hearing from you.
0 reviews or Q&As
Loading...
Have you used Mouse Anti-IDH1 Recombinant Antibody (16H7)?
Submit a review and get a Coupon or an Amazon gift card. 20% off Coupon $30 eGift Card
Submit a review
Loading...
For research use only. Not intended for any clinical use.

Custom Antibody Labeling

We also offer labeled antibodies developed using our catalog antibody products and nonfluorescent conjugates (HRP, AP, Biotin, etc.) or fluorescent conjugates (Alexa Fluor, FITC, TRITC, Rhodamine, Texas Red, R-PE, APC, Qdot Probes, Pacific Dyes, etc.).

Learn more

Documents

Online Inquiry