Search :
Sign in or Register  
Welcome Sign in or Don't have an account?Register

Recombinant Mouse Anti-GDF9 Recombinant Antibody (53/1) (CBMAB-XB0490-YC)

Online Inquiry

Summary

Host Animal
Mouse
Specificity
Human
Clone
53/1
Antibody Isotype
IgG1
Application
ELISA, IHC, WB

Basic Information

Immunogen
Tuberculin coupled peptide with sequence VPAKYSPLSVLTIEPDGSIAYKEYEDMIATKC that recognizes an epitope with the EPDG sequence near the C-terminal region of human GDF9
Specificity
Human
Antibody Isotype
IgG1
Clonality
Monoclonal
Application Notes
The COA includes recommended starting dilutions, optimal dilutions should be determined by the end user.

Formulations & Storage [For reference only, actual COA shall prevail!]

Storage
Store at 4°C short term (1-2 weeks). Aliquot and store at-20°C long term. Avoid repeated freeze/thaw cycles.

Target

Full Name
Growth Differentiation Factor 9
Introduction
GDF9 is a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate gene expression. The encoded preproprotein is proteolytically processed to generate each subunit of the disulfide-linked homodimer. This protein regulates ovarian function. Reduced expression of this gene may be associated with polycystic ovary syndrome and mutations in this gene may be more common in mothers of dizygotic twins.
Entrez Gene ID
UniProt ID
Alternative Names
Growth Differentiation Factor 9; GDF-9;
Function
Required for ovarian folliculogenesis. Promotes primordial follicle development. Stimulates granulosa cell proliferation. Promotes cell transition from G0/G1 to S and G2/M phases, through an increase of CCND1 and CCNE1 expression, and RB1 phosphorylation. It regulates STAR expression and cAMP-dependent progesterone release in granulosa and thecal cells. Attenuates the suppressive effects of activin A on STAR expression and progesterone production by increasing the expression of inhibin B. It suppresses FST and FSTL3 production in granulosa-lutein cells.
Biological Process
BMP signaling pathway Source: GO_Central
Female gamete generation Source: ProtInc
Negative regulation of cell growth Source: Ensembl
Oocyte growth Source: Ensembl
Positive regulation of cell population proliferation Source: UniProtKB
Positive regulation of pathway-restricted SMAD protein phosphorylation Source: GO_Central
Regulation of progesterone secretion Source: UniProtKB
SMAD protein signal transduction Source: GO_Central
Transforming growth factor beta receptor signaling pathway Source: ProtInc
Cellular Location
Secreted
Involvement in disease
Altered GDF9 function may be involved in ovarian disorders and contribute to the likelihood of dizygotic twinning.
Premature ovarian failure 14 (POF14):
An ovarian disorder defined as the cessation of ovarian function under the age of 40 years. It is characterized by oligomenorrhea or amenorrhea, in the presence of elevated levels of serum gonadotropins and low estradiol.
PTM
Phosphorylated; phosphorylation is critical for GDF9 function. In vitro, can be phosphorylated by CK at Ser-325.
More Infomation
Ask a question We look forward to hearing from you.
0 reviews or Q&As
Loading...
Have you used Recombinant Mouse Anti-GDF9 Recombinant Antibody (53/1)?
Submit a review and get a Coupon or an Amazon gift card. 20% off Coupon $30 eGift Card
Submit a review
Loading...
For research use only. Not intended for any clinical use.

Custom Antibody Labeling

We also offer labeled antibodies developed using our catalog antibody products and nonfluorescent conjugates (HRP, AP, Biotin, etc.) or fluorescent conjugates (Alexa Fluor, FITC, TRITC, Rhodamine, Texas Red, R-PE, APC, Qdot Probes, Pacific Dyes, etc.).

Learn more

Documents

Online Inquiry