Search :
Sign in or Register  
Welcome Sign in or Don't have an account?Register

Mouse Anti-FBXO7 Monoclonal Antibody (4G8) (CBMAB-1238-YC)

Online Inquiry

Summary

Host Animal
Mouse
Specificity
Human
Clone
4G8
Antibody Isotype
IgG2a, κ
Application
ELISA, ICC, IF, WB

Basic Information

Immunogen
Partial recombinant protein FBXO7 (NP_036311, aa 357-456) with GST tag (AVCRDLFTASNDPLLWRFLYLRDFRDNTVRVQDTDWKELYRKRHIQRKESPKGRFVMLLPSSTHTIPFYPNPLHPRPFPSSRLPPGIIGGEYDQRPTLP)
Specificity
Human
Antibody Isotype
IgG2a, κ
Clonality
Monoclonal
Application Notes
The COA includes recommended starting dilutions, optimal dilutions should be determined by the end user.

Formulations & Storage [For reference only, actual COA shall prevail!]

Format
Liquid
Storage
Store at 4°C short term (1-2 weeks). Aliquot and store at -20°C long term. Avoid repeated freeze/thaw cycles.

Target

Full Name
F-Box Protein 7
Introduction
The F-box proteins constitute one of the four subunits of the ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. FBXO7 is a member of the F-box protein family which is characterized by an approximately 40 amino acid motif. FBXO7 may play a role in regulation of hematopoiesis.
Entrez Gene ID
UniProt ID
Alternative Names
FBX; FBX7; PKPS; FBX07; PARK15
Research Area
Substrate recognition component of a SCF (SKP1-CUL1-F-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. Recognizes BIRC2 and DLGAP5. Plays a role downstream of PINK1 in the clearance of damaged mitochondria via selective autophagy (mitophagy) by targeting PRKN to dysfunctional depolarized mitochondria. Promotes MFN1 ubiquitination.
Biological Process
Autophagy of mitochondrion Source: UniProtKB
Negative regulation of cyclin-dependent protein serine/threonine kinase activity Source: Ensembl
Negative regulation of G1/S transition of mitotic cell cycle Source: Ensembl
Negative regulation of hydrogen peroxide-induced neuron death Source: ParkinsonsUK-UCL
Negative regulation of lymphocyte differentiation Source: Ensembl
Negative regulation of oxidative stress-induced neuron death Source: ParkinsonsUK-UCL
Positive regulation of autophagy of mitochondrion Source: ParkinsonsUK-UCL
Protein targeting to mitochondrion Source: UniProtKB
Protein ubiquitination Source: ParkinsonsUK-UCL
Regulation of locomotion Source: ParkinsonsUK-UCL
Regulation of neuron projection development Source: ParkinsonsUK-UCL
Regulation of protein stability Source: UniProtKB
Ubiquitin-dependent protein catabolic process Source: ParkinsonsUK-UCL
Cellular Location
Mitochondrion; Nucleus; Cytoplasm; Cytosol. Predominantly cytoplasmic (PubMed:16096642). A minor proportion is detected in the nucleus (PubMed:16096642). Relocates from the cytosol to depolarized mitochondria (PubMed:23933751).
Involvement in disease
Parkinson disease 15 (PARK15):
A neurodegenerative disorder characterized by parkinsonian and pyramidal signs. Clinical manifestations include tremor, bradykinesia, rigidity, postural instability, spasticity, mainly in the lower limbs, and hyperreflexia.
More Infomation

Zhong, Y., Li, J., Ye, M., & Jin, X. (2022). The characteristics of FBXO7 and its role in human diseases. Gene, 146972.

Palmer, M. C., Neudorf, N. M., Farrell, A. C., Razi, T., Lichtensztejn, Z., & McManus, K. J. (2022). The F-box protein, FBXO7, is required to maintain chromosome stability in humans. Human molecular genetics, 31(9), 1471-1486.

Harris, R., Yang, M., Schmidt, C., Royet, C., Singh, S., Natarajan, A., ... & Laman, H. (2022). Fbxo7 promotes Cdk6 activity to inhibit PFKP and glycolysis in T cells. Journal of Cell Biology, 221(7), e202203095.

Shen, J. Z., Qiu, Z., Wu, Q., Zhang, G., Harris, R., Sun, D., ... & Spruck, C. (2022). A FBXO7/EYA2-SCFFBXW7 axis promotes AXL-mediated maintenance of mesenchymal and immune evasion phenotypes of cancer cells. Molecular Cell, 82(6), 1123-1139.

Noda, S., Sato, S., Fukuda, T., Ueno, S., Tada, N., & Hattori, N. (2022). Impaired mitochondrial accumulation and Lewy pathology in neuron-specific FBXO7-deficient mice. Molecular Brain, 15(1), 1-5.

Lee, S. H., Jung, S., Lee, Y. J., Hyun, M., & Chung, K. C. (2021). FBXO7 triggers caspase 8-mediated proteolysis of the transcription factor FOXO4 and exacerbates neuronal cytotoxicity. Journal of Biological Chemistry, 297(6).

Huang, T., Fang, L., He, R., Weng, H., Chen, X., Ye, Q., & Qu, D. (2021). Fbxo7 and Pink1 play a reciprocal role in regulating their protein levels. Aging (Albany NY), 13(1), 77.

Liu, Y., Lear, T. B., Verma, M., Wang, K. Z., Otero, P. A., McKelvey, A. C., ... & Mallampalli, R. K. (2020). Chemical inhibition of FBXO7 reduces inflammation and confers neuroprotection by stabilizing the mitochondrial kinase PINK1. JCI insight, 5(11).

Correa‐Vela, M., Lupo, V., Montpeyó, M., Sancho, P., Marcé‐Grau, A., Hernández‐Vara, J., ... & Espinós, C. (2020). Impaired proteasome activity and neurodegeneration with brain iron accumulation in FBXO7 defect. Annals of clinical and translational neurology, 7(8), 1436-1442.

Joseph, S., Schulz, J. B., & Stegmüller, J. (2018). Mechanistic contributions of FBXO7 to Parkinson disease. Journal of neurochemistry, 144(2), 118-127.

Ask a question We look forward to hearing from you.
0 reviews or Q&As
Loading...
Have you used Mouse Anti-FBXO7 Monoclonal Antibody (4G8)?
Submit a review and get a Coupon or an Amazon gift card. 20% off Coupon $30 eGift Card
Submit a review
Loading...
For research use only. Not intended for any clinical use.

Custom Antibody Labeling

We also offer labeled antibodies developed using our catalog antibody products and nonfluorescent conjugates (HRP, AP, Biotin, etc.) or fluorescent conjugates (Alexa Fluor, FITC, TRITC, Rhodamine, Texas Red, R-PE, APC, Qdot Probes, Pacific Dyes, etc.).

Learn more

Documents

Online Inquiry