Search :
Sign in or Register  
Welcome Sign in or Don't have an account?Register

Mouse Anti-FABP7 Recombinant Antibody (CBXF-2444) (CBMAB-F2017-CQ)

Online Inquiry

Summary

Host Animal
Mouse
Specificity
Human
Clone
CBXF-2444
Antibody Isotype
IgG1
Application
WB, IHC, IHC-P

Basic Information

Immunogen
Recombinant protein corresponding to amino acids: MVEAFCATWKLTNSQNFDEYMKALGVGFATRQVGNVTKPTVIISQEGDKVVIRTLSTFKNTEISFQLGEEFDETTADDRNCK
Specificity
Human
Antibody Isotype
IgG1
Clonality
Monoclonal
Application Notes
The COA includes recommended starting dilutions, optimal dilutions should be determined by the end user.

Formulations & Storage [For reference only, actual COA shall prevail!]

Storage
Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C long term. Avoid repeated freeze/thaw cycles.

Target

Full Name
Fatty Acid Binding Protein 7
Introduction
The gene encodes a small, highly conserved cytoplasmic protein that bind long-chain fatty acids and other hydrophobic ligands. The encoded protein is important in the establishment of the radial glial fiber in the developing brain. Alternative splicing and promoter usage results in multiple transcript variants encoding different isoforms. Pseudogenes of this gene are found on multiple chromosomes.
Entrez Gene ID
UniProt ID
Alternative Names
Fatty Acid Binding Protein 7; Brain-Type Fatty Acid-Binding Protein; Brain Lipid-Binding Protein; B-FABP; FABPB; BLBP; MRG; Mammary-Derived Growth Inhibitor-Related;
Research Area
B-FABP could be involved in the transport of a so far unknown hydrophobic ligand with potential morphogenic activity during CNS development. It is required for the establishment of the radial glial fiber system in developing brain, a system that is necessary for the migration of immature neurons to establish cortical layers (By similarity).
Biological Process
Epithelial cell proliferation Source: Ensembl
Negative regulation of cell population proliferation Source: ProtInc
Nervous system development Source: ProtInc
Cellular Location
Cytoplasm
More Infomation

Zeng, F., Luo, L., Song, M., & Li, D. (2022). Silencing of circular RNA PUM1 inhibits clear cell renal cell carcinoma progression through the miR-340-5p/FABP7 axis. Journal of Receptors and Signal Transduction, 42(2), 141-150.

Nowowiejska, J., Baran, A., Hermanowicz, J. M., Sieklucka, B., Krahel, J. A., Kiluk, P., ... & Flisiak, I. (2022). Fatty Acid-Binding Protein 7 (FABP-7), Glutamic Acid and Neurofilament Light Chain (NFL) as Potential Markers of Neurodegenerative Disorders in Psoriatic Patients—A Pilot Study. Journal of clinical medicine, 11(9), 2430.

Umaru, B. A., Kagawa, Y., Shil, S. K., Arakawa, N., Pan, Y., Miyazaki, H., ... & Owada, Y. (2021). Ligand bound fatty acid binding protein 7 (FABP7) drives melanoma cell proliferation via modulation of wnt/β-catenin signaling. Pharmaceutical research, 38(3), 479-490.

Choi, W. S., Xu, X., Goruk, S., Wang, Y., Patel, S., Chow, M., ... & Godbout, R. (2021). FABP7 Facilitates Uptake of Docosahexaenoic Acid in Glioblastoma Neural Stem-like Cells. Nutrients, 13(8), 2664.

Chen, J., Liu, X., Zhang, S., Chen, J., Sun, H., Zhang, L., & Zhang, Q. (2020). Molecular mechanism with regard to the binding selectivity of inhibitors toward FABP5 and FABP7 explored by multiple short molecular dynamics simulations and free energy analyses. Physical Chemistry Chemical Physics, 22(4), 2262-2275.

Killoy, K. M., Harlan, B. A., Pehar, M., & Vargas, M. R. (2020). FABP7 upregulation induces a neurotoxic phenotype in astrocytes. Glia, 68(12), 2693-2704.

Kagawa, Y., Umaru, B. A., Ariful, I., Shil, S. K., Miyazaki, H., Yamamoto, Y., ... & Owada, Y. (2019). Role of FABP7 in tumor cell signaling. Advances in biological regulation, 71, 206-218.

Cordero, A., Kanojia, D., Miska, J., Panek, W. K., Xiao, A., Han, Y., ... & Lesniak, M. S. (2019). FABP7 is a key metabolic regulator in HER2+ breast cancer brain metastasis. Oncogene, 38(37), 6445-6460.

Islam, A., Kagawa, Y., Miyazaki, H., Shil, S. K., Umaru, B. A., Yasumoto, Y., ... & Owada, Y. (2019). FABP7 protects astrocytes against ROS toxicity via lipid droplet formation. Molecular Neurobiology, 56(8), 5763-5779.

Yasumoto, Y., Miyazaki, H., Ogata, M., Kagawa, Y., Yamamoto, Y., Islam, A., ... & Owada, Y. (2018). Glial fatty acid-binding protein 7 (FABP7) regulates neuronal leptin sensitivity in the hypothalamic arcuate nucleus. Molecular Neurobiology, 55(12), 9016-9028.

Ask a question We look forward to hearing from you.
0 reviews or Q&As
Loading...
Have you used Mouse Anti-FABP7 Recombinant Antibody (CBXF-2444)?
Submit a review and get a Coupon or an Amazon gift card. 20% off Coupon $30 eGift Card
Submit a review
Loading...
For research use only. Not intended for any clinical use.

Custom Antibody Labeling

We also offer labeled antibodies developed using our catalog antibody products and nonfluorescent conjugates (HRP, AP, Biotin, etc.) or fluorescent conjugates (Alexa Fluor, FITC, TRITC, Rhodamine, Texas Red, R-PE, APC, Qdot Probes, Pacific Dyes, etc.).

Learn more

Documents

Online Inquiry